Nav1.5 (SCN5A) Rabbit Polyclonal Antibody

CAT#: TA338381

Rabbit Polyclonal Anti-SCN5A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,200.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SCN5A antibody is: synthetic peptide directed towards the C-terminal region of Human SCN5A. Synthetic peptide located within the following region: VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 227 kDa
Gene Name sodium voltage-gated channel alpha subunit 5
Background The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. This protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Synonyms CDCD2; CMD1E; CMPD2; HB1; HB2; HBBD; HH1; ICCD; IVF; LQT3; Nav1.5; PFHB1; SSS1; VF1
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%
Reference Data
Protein Families Druggable Genome, Ion Channels: Sodium, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...