NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	IHC, WB
Reactivity	Human, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	163 kDa
Gene Name	glutamate ionotropic receptor NMDA type subunit 2A
Database Link	NP_000824 Entrez Gene 24409 RatEntrez Gene 2903 Human UniProt ID Q12879
Background	This gene encodes a member of the glutamate-gated ion channel protein family. The encoded protein is an N-methyl-D-aspartate (NMDA) receptor subunit. NMDA receptors are both ligand-gated and voltage-dependent, and are involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. These receptors are permeable to calcium ions, and activation results in a calcium influx into post-synaptic cells, which results in the activation of several signaling cascades. Disruption of this gene is associated with focal epilepsy and speech disorder with or without mental retardation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
Synonyms	EPND; FESD; GluN2A; LKS; NMDAR2A; NR2A
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 86%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79%; Bovine: 77%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Glutamate Receptors, Ion Channels: Sodium, Transmembrane
Protein Pathways	Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Calcium signaling pathway, Long-term potentiation, Neuroactive ligand-receptor interaction, Systemic lupus erythematosus

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.