KCNQ3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse, Hamster
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	97 kDa
Gene Name	potassium voltage-gated channel subfamily Q member 3
Database Link	NP_004510 Entrez Gene 110862 Mouse UniProt ID O43525
Background	Probably important in the regulation of neuronal excitability. Associates with KCNQ2 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.
Synonyms	BFNC2; EBN2; KV7.3
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Potassium, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.