ARV1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ARV1 antibody: synthetic peptide directed towards the middle region of human ARV1. Synthetic peptide located within the following region: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	ARV1 homolog, fatty acid homeostasis modulator
Database Link	NP_073623 Entrez Gene 64801 Human UniProt ID Q9H2C2
Background	ARV1 may act as a mediator of sterol homeostasis.
Synonyms	ARV1 homolog; ARV1 homolog (S. cerevisiae); OTTHUMP00000035970
Note	Immunogen Sequence Homology: Human: 100%; Pig: 85%; Goat: 85%; Bovine: 85%; Dog: 79%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.