CYP3A43 Rabbit Polyclonal Antibody

CAT#: TA338622

Rabbit Polyclonal Anti-CYP3A43 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2
    • 100 ug

CNY 4,840.00


Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the C terminal of human CYP3A43. Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 58 kDa
Gene Name cytochrome P450 family 3 subfamily A member 43
Background CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms.
Synonyms MGC119315; MGC119316
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Sheep: 92%; Bovine: 92%; Dog: 86%; Goat: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 80%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Linoleic acid metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...