TRPM8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	128 kDa
Gene Name	transient receptor potential cation channel subfamily M member 8
Database Link	NP_076985 Entrez Gene 79054 Human UniProt ID Q7Z2W7
Background	TRPM8 is the receptor-activated non-selective cation channel involved in detection of sensations such as coolness, by being activated by cold temperature below 25 degrees Celsius. TRPM8 is activated by icilin, eucalyptol, menthol, cold and modulation of intracellular pH. TRPM8 is involved in menthol sensation. TRPM8 is permeable for monovalent cations sodium, potassium, and cesium and divalent cation calcium. Temperature sensing is tightly linked to voltage-dependent gating. TRPM8 was activated upon depolarization, changes in temperature resulting in graded shifts of its voltage-dependent activation curves. The chemical agonists menthol functions as a gating modifier, shifting activation curves towards physiological membrane potentials. Temperature sensitivity arises from a tenfold difference in the activation energies associated with voltage-dependent opening and closing.
Synonyms	LTRPC6; TRPP8
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.