KCNH6 Rabbit Polyclonal Antibody
CAT#: TA338763
Rabbit Polyclonal Anti-KCNH6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6. Synthetic peptide located within the following region: LSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQPGKSSADVRAL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 109 kDa |
Gene Name | potassium voltage-gated channel subfamily H member 6 |
Database Link | |
Background | Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013] |
Synonyms | ERG-2; ERG2; hERG-2; HERG2; Kv11.2 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |