LGICZ1 (ZACN) Rabbit Polyclonal Antibody

CAT#: TA338782

Rabbit Polyclonal Anti-LGICZ1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of zinc activated ligand-gated ion channel (ZACN)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-LGICZ1 antibody: synthetic peptide directed towards the N terminal of human LGICZ1. Synthetic peptide located within the following region: PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 46 kDa
Gene Name zinc activated ion channel
Background LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels (Davies et al., 2003 [PubMed 12381728]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AB223030.1, BC110597.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms L2; LGICZ; LGICZ1; ZAC; ZAC1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Rabbit: 86%; Bovine: 85%
Reference Data
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...