Fbxo32 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Fbxo32 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	F-box protein 32
Database Link	NP_080622 Entrez Gene 67731 Mouse UniProt ID Q9CPU7
Background	Fbxo32 is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy.
Synonyms	Atrogin-1; ATROGIN1; Fbx32; FLJ32424; MAFbx; MGC33610
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 92%; Rabbit: 92%; Zebrafish: 92%; Mouse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.