TRAM1L1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRAM1L1 antibody: synthetic peptide directed towards the middle region of human TRAM1L1. Synthetic peptide located within the following region: LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	translocation associated membrane protein 1-like 1
Database Link	NP_689615 Entrez Gene 133022 Human UniProt ID Q8N609
Background	TRAM1L1 is stimulatory or required for the translocation of secretory proteins across the ER membrane.
Synonyms	MGC26568
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.