PSMG1 Rabbit Polyclonal Antibody
CAT#: TA338920
Rabbit Polyclonal Anti-PSMG1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PSMG1 antibody: synthetic peptide directed towards the middle region of human PSMG1. Synthetic peptide located within the following region: TILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 30 kDa |
Gene Name | proteasome assembly chaperone 1 |
Database Link | |
Background | PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization. |
Synonyms | C21LRP; DSCR2; LRPC21; PAC-1; PAC1 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |