TSPAN2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TSPAN2 antibody: synthetic peptide directed towards the middle region of human TSPAN2. Synthetic peptide located within the following region: FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	tetraspanin 2
Database Link	NP_005716 Entrez Gene 10100 Human UniProt ID O60636
Background	The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008]
Synonyms	NET3; TSN2; TSPAN-2
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 86%; Rabbit: 86%; Dog: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.