ZNF133 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, WB
Recommend Dilution	WB, IF
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the N terminal of human ZNF133. Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	zinc finger protein 133
Database Link	NP_003425 Entrez Gene 7692 Human UniProt ID P52736
Background	May be involved in transcriptional regulation as a repressor.
Synonyms	pHZ-13; pHZ-66; ZNF150
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 93%; Horse: 92%; Mouse: 83%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.