N myc interactor (NMI) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NMI antibody: synthetic peptide directed towards the N terminal of human NMI. Synthetic peptide located within the following region: ETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	N-myc and STAT interactor
Database Link	NP_004679 Entrez Gene 9111 Human UniProt ID Q13287
Background	NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq, Jul 2008]
Synonyms	N-myc (and STAT) interactor; N-myc-interactor; N-myc and STAT interactor; N-myc interactor
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 90%; Horse: 90%; Mouse: 90%; Guinea pig: 90%; Rabbit: 83%; Rat: 77%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.