Kmt5b Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	10k-ChIP, WB
Recommend Dilution	WB, ChIP
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	. Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	suppressor of variegation 4-20 homolog 1 (Drosophila)
Database Link	NP_001161356 Entrez Gene 51111 HumanEntrez Gene 225888 Mouse UniProt ID Q3U8K7
Background	Suv420h1 is a histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. It mainly functions in pericentric heterochromatin region
Synonyms	C630029K18Rik; CGI-85; CGI85; KMT5B; MGC703; MGC21161; MGC118906; MGC118909; OTTHUMP00000197482; OTTHUMP00000197488; Suv4-20h1
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Pig: 86%; Guinea pig: 86%; Rabbit: 77%; Zebrafish: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.