Plasminogen (PLG) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PLG antibody: synthetic peptide directed towards the middle region of human PLG. Synthetic peptide located within the following region: LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	88 kDa
Gene Name	plasminogen
Database Link	NP_000292 Entrez Gene 5340 Human UniProt ID P00747
Background	The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasmin dissolves fibrin in blood clots and is an important protease in many other cellular processes while angiostatin
Synonyms	DKFZp779M0222
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Dog: 79%; Rat: 79%; Mouse: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Protease, Secreted Protein
Protein Pathways	Complement and coagulation cascades, Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.