KIAA0020 (PUM3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the N terminal of human KIAA0020. Synthetic peptide located within the following region: EVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVTSR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	pumilio RNA binding family member 3
Database Link	NP_055693 Entrez Gene 9933 Human UniProt ID Q15397
Background	KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.
Synonyms	HA-8; HLA-HA8; KIAA0020; PEN; PUF-A; PUF6; XTP5
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Rabbit: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.