sphingosine 1 phosphate phosphatase 1 (SGPP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SGPP1 antibody: synthetic peptide directed towards the middle region of human SGPP1. Synthetic peptide located within the following region: THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	sphingosine-1-phosphate phosphatase 1
Database Link	NP_110418 Entrez Gene 81537 Human UniProt ID Q9BX95
Background	Sphingosine-1-phosphate (S1P) is a bioactive sphingolipid metabolite that regulates diverse biologic processes. SGPP1 catalyzes the degradation of S1P via salvage and recycling of sphingosine into long-chain ceramides (Mandala et al., 2000 [PubMed 10859351]; Le Stunff et al., 2007 [PubMed 17895250]).
Synonyms	SPPase1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome, Phosphatase, Transmembrane
Protein Pathways	Sphingolipid metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.