Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-APOL2 antibody: synthetic peptide directed towards the middle region of human APOL2. Synthetic peptide located within the following region: DVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	apolipoprotein L2
Database Link	NP_112092 Entrez Gene 23780 Human UniProt ID Q9BQE5
Background	This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene.
Synonyms	APOL-II; APOL3
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.