ABHD13 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ABHD13 antibody: synthetic peptide directed towards the C terminal of human ABHD13. Synthetic peptide located within the following region: LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	abhydrolase domain containing 13
Database Link	NP_116248 Entrez Gene 84945 Human UniProt ID Q7L211
Background	ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms	bA153I24.2; BEM46L1; C13orf6
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 93%
Reference Data
Protein Families	Protease, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.