ARID3C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ARID3C antibody: synthetic peptide directed towards the C terminal of human ARID3C. Synthetic peptide located within the following region: MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	AT-rich interaction domain 3C
Database Link	NP_001017363 Entrez Gene 138715 Human UniProt ID A6NKF2
Background	ARID3C is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-318 AL450283.16 15235-15552 c 319-391 AL450283.16 13280-13352 c 392-575 AL450283.16 11402-11585 c 576-865 AL450283.16 10963-11252 c 866-1048 AL450283.16 9885-10067 c 1049-1138 AL450283.16 9558-9647 c 1139-1239 AL450283.16 8996-9096 c
Synonyms	AT rich interactive domain 3C (BRIGHT- like); AT rich interactive domain 3C (BRIGHT-like)
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Bovine: 92%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.