EIF3S3 (EIF3H) Rabbit Polyclonal Antibody
CAT#: TA339679
Rabbit Polyclonal Anti-EIF3H Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EIF3H antibody: synthetic peptide directed towards the C terminal of human EIF3H. Synthetic peptide located within the following region: LMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | eukaryotic translation initiation factor 3 subunit H |
Database Link | |
Background | EIF3H belongs to the peptidase M67 family. It contains 1 MPN (JAB/Mov34) domain. EIF3H binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. It associates with the p170 subunit of EIF3. |
Synonyms | eIF3-gamma; eIF3-p40; EIF3S3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 75% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |