ZNHIT3 Rabbit Polyclonal Antibody
CAT#: TA339683
Rabbit Polyclonal Anti-ZNHIT3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNHIT3 antibody: synthetic peptide directed towards the N terminal of human ZNHIT3. Synthetic peptide located within the following region: HKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 17 kDa |
Gene Name | zinc finger HIT-type containing 3 |
Database Link | |
Background | ZNHIT3 contains 1 HIT-type zinc finger. The exact function of ZNHIT3 remains unknown. |
Synonyms | TRIP3 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |