SMYD4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SMYD4 antibody: synthetic peptide directed towards the N terminal of human SMYD4. Synthetic peptide located within the following region: EGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDMSLCHANRSAALFHLGQYE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	89 kDa
Gene Name	SET and MYND domain containing 4
Database Link	NP_443160 Entrez Gene 114826 Human UniProt ID Q8IYR2
Background	The exact function of SMYD4 remains unknown.
Synonyms	ZMYND21
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Dog: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.