ZNF565 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF565 antibody: synthetic peptide directed towards the middle region of human ZNF565. Synthetic peptide located within the following region: VSQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECREC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	zinc finger protein 565
Database Link	NP_689690 Entrez Gene 147929 Human UniProt ID Q8N9K5
Background	ZNF565 may be involved in transcriptional regulation.
Synonyms	FLJ36991
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 86%; Mouse: 83%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.