KTEL1 (POGLUT1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-POGLUT1 antibody is: synthetic peptide directed towards the N-terminal region of Human POGLUT1. Synthetic peptide located within the following region: FLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	protein O-glucosyltransferase 1
Database Link	NP_689518 Entrez Gene 56983 Human UniProt ID Q8NBL1
Background	POGLUT1 is a UDP-glucosyltransferase.
Synonyms	C3orf9; CLP46; hCLP46; KDELCL1; KTELC1; MDS010; MDSRP; Rumi
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Horse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.