C3orf10 (BRK1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C3orf10 antibody: synthetic peptide directed towards the middle region of human C3orf10. Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	9 kDa
Gene Name	BRICK1, SCAR/WAVE actin nucleating complex subunit
Database Link	NP_060932 Entrez Gene 55845 Human UniProt ID Q8WUW1
Background	C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
Synonyms	C3orf10; hHBrk1; HSPC300; MDS027
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%
Reference Data
Protein Pathways	Regulation of actin cytoskeleton

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.