Tbcb Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tbcb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	tubulin folding cofactor B
Database Link	NP_079824 Entrez Gene 66411 Mouse UniProt ID Q9D1E6
Background	Tbcb binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. It may function as a negative regulator of axonal growth.
Synonyms	CG22; CKAP1; CKAPI
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.