RAB40B Rabbit Polyclonal Antibody
CAT#: TA340141
Rabbit Polyclonal Anti-RAB40B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAB40B antibody: synthetic peptide directed towards the middle region of human RAB40B. Synthetic peptide located within the following region: YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | RAB40B, member RAS oncogene family |
Database Link | |
Background | RAB40B has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles.The protein encoded by this gene has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles. |
Synonyms | RAR; SEC4L |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 92%; Bovine: 92%; Yeast: 82% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |