PIM2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIM2 antibody: synthetic peptide directed towards the middle region of human PIM2. Synthetic peptide located within the following region: LRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	Pim-2 proto-oncogene, serine/threonine kinase
Database Link	NP_006866 Entrez Gene 11040 Human UniProt ID Q9P1W9
Background	This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.
Synonyms	Pim-2h
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 79%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Acute myeloid leukemia

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.