GBP5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GBP5 antibody is: synthetic peptide directed towards the N-terminal region of Human GBP5. Synthetic peptide located within the following region: LHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTLRDFCLGLEIDG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	guanylate binding protein 5
Database Link	NP_443174 Entrez Gene 115362 Human UniProt ID Q96PP8
Background	GBP5 stimulates the NLRP3 inflammasome assembly upon bacterial challenge.
Synonyms	GBP-5
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.