C6orf150 (MB21D1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MB21D1 antibody: synthetic peptide directed towards the middle region of human MB21D1. Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	Mab-21 domain containing 1
Database Link	NP_612450 Entrez Gene 115004 Human UniProt ID Q8N884
Background	The exact function of MB21D1 remains unknown.
Synonyms	C6orf150; cGAS; h-cGAS
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 86%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.