DIRAS1 Rabbit Polyclonal Antibody

CAT#: TA340390

Rabbit Polyclonal Anti-DIRAS1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 1 (DIRAS1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human DIRAS family, GTP-binding RAS-like 1 (DIRAS1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human DIRAS family, GTP-binding RAS-like 1 (DIRAS1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DIRAS1 antibody: synthetic peptide directed towards the middle region of human DIRAS1. Synthetic peptide located within the following region: KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 22 kDa
Gene Name DIRAS family GTPase 1
Background DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases. DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases. [supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3390 BC030660.1 2-3391
Synonyms Di-Ras1; GBTS1; RIG
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Dog: 86%; Rat: 79%; Mouse: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...