OMA1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Fish
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60
Gene Name	OMA1 zinc metallopeptidase
Database Link	NP_660286 Entrez Gene 115209 Human UniProt ID Q96E52
Background	OMA1 is a mitochondrial protease.
Synonyms	2010001O09Rik; DAB1; MPRP-1; peptidase; YKR087C; ZMPOMA1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Bovine: 85%; Zebrafish: 85%; Yeast: 83%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Protease, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.