HOXB8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HOXB8 antibody: synthetic peptide directed towards the middle region of human HOXB8. Synthetic peptide located within the following region: FQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKGDKK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	homeobox B8
Database Link	NP_076921 Entrez Gene 3218 Human UniProt ID P17481
Background	This gene is a member ofThe Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17.The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression ofThis gene is associated with colorectal cancer. Mice that have hadThe murine ortholog ofThis gene knocked out exhibit an excessive pathologic grooming behavior.This behavior is similar toThe behavior of humans suffering fromThe obsessive-compulsive spectrum disorder trichotillomania. [provided by RefSeq, Jul 2008]
Synonyms	Hox-2.4; HOX2; HOX2D
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	ES Cell Differentiation/IPS

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.