HOXB8 Rabbit Polyclonal Antibody

CAT#: TA341387

Rabbit Polyclonal Anti-HOXB8 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of homeobox B8 (HOXB8)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HOXB8 antibody: synthetic peptide directed towards the middle region of human HOXB8. Synthetic peptide located within the following region: FQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKGDKK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 27 kDa
Gene Name homeobox B8
Background This gene is a member ofThe Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17.The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression ofThis gene is associated with colorectal cancer. Mice that have hadThe murine ortholog ofThis gene knocked out exhibit an excessive pathologic grooming behavior.This behavior is similar toThe behavior of humans suffering fromThe obsessive-compulsive spectrum disorder trichotillomania. [provided by RefSeq, Jul 2008]
Synonyms Hox-2.4; HOX2; HOX2D
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families ES Cell Differentiation/IPS
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...