ZNF323 (ZSCAN31) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF323 antibody: synthetic peptide directed towards the middle region of human ZNF323. Synthetic peptide located within the following region: QEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	zinc finger and SCAN domain containing 31
Database Link	NP_665916 Entrez Gene 64288 Human UniProt ID Q96LW9
Background	ZNF323 is a member ofThe subfamily of C2H2 Kruppel-like zinc finger transcription factors that have a SCAN box domain (Pi et al., 2002 [PubMed 12147252]). [supplied by OMIM, Mar 2008]. Transcript Variant:This variant (1) encodes isoform 1. Variants 1, 4 and 7 encodeThe same protein. ##Evidence-Data-START## Transcript exon combination :: BC008490.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025083 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms	dJ874C20.2; FLJ23407; ZNF20-Lp; ZNF310P
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.