ZNF323 (ZSCAN31) Rabbit Polyclonal Antibody
CAT#: TA341411
Rabbit Polyclonal Anti-ZNF323 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF323 antibody: synthetic peptide directed towards the middle region of human ZNF323. Synthetic peptide located within the following region: QEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | zinc finger and SCAN domain containing 31 |
Database Link | |
Background | ZNF323 is a member ofThe subfamily of C2H2 Kruppel-like zinc finger transcription factors that have a SCAN box domain (Pi et al., 2002 [PubMed 12147252]). [supplied by OMIM, Mar 2008]. Transcript Variant:This variant (1) encodes isoform 1. Variants 1, 4 and 7 encodeThe same protein. ##Evidence-Data-START## Transcript exon combination :: BC008490.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025083 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end. |
Synonyms | dJ874C20.2; FLJ23407; ZNF20-Lp; ZNF310P |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |