ZNF397 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF397 antibody: synthetic peptide directed towards the middle region of human ZNF397. Synthetic peptide located within the following region: VQQHNPESGEEAVTLLEDLEREFDDPGQQVPASPQGPAVPWKDLTCLRAS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	zinc finger protein 397
Database Link	NP_001128650 Entrez Gene 84307 Human UniProt ID Q8NF99
Background	This gene encodes a protein with a N-terminal SCAN domain, andThe longer isoform contains nine C2H2-type zinc finger repeats inThe C-terminal domain.The protein localizes to centromeres during interphase and early prophase, and different isoforms can repress or activate transcription in transfection studies. Multiple transcript variants encoding different isoforms have been found forThis gene. Additional variants have been described, butTheir biological validity has not been determined. [provided by RefSeq, Oct 2009]
Synonyms	ZNF47; ZSCAN15
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Dog: 75%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.