QRX (RAX2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAXL1 antibody: synthetic peptide directed towards the N terminal of human RAXL1. Synthetic peptide located within the following region: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	retina and anterior neural fold homeobox 2
Database Link	NP_116142 Entrez Gene 84839 Human UniProt ID Q96IS3
Background	This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation ofThis gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneathThe retinal pigment epithelium and withinThe Bruch's membrane. Defects inThis gene can also cause cone-rod dystrophy type 11, a disease characterized byThe initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed byThe degeneration of rod photoreceptor cells, which progresses to night blindness andThe loss of peripheral vision. [provided by RefSeq, Jul 2008]
Synonyms	ARMD6; CORD11; QRX; RAXL1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.