Cyclin B3 (CCNB3) Rabbit Polyclonal Antibody

CAT#: TA341424

Rabbit Polyclonal Anti-CCNB3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the N terminal of human CCNB3. Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 33 kDa
Gene Name cyclin B3
Background The protein encoded byThis gene belongs toThe highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughThe cell cycle. Cyclins function as positive regulators of cyclin-dependent kinases (CDKs), andThereby play an essential role inThe control ofThe cell cycle. Different cyclins exhibit distinct expression and degradation patterns, which contribute toThe temporal coordination of each mitotic event. Studies of similar genes in chicken and drosophila suggest thatThis cyclin may associate with CDC2 and CDK2 kinases, and may be required for proper spindle reorganization and restoration ofThe interphase nucleus. Alternatively spliced transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, Oct 2011]
Synonyms cyclin B3; OTTHUMP00000023292; OTTHUMP00000023293
Note Immunogen Sequence Homology: Human: 100%; Dog: 82%
Reference Data
Protein Families Druggable Genome
Protein Pathways Cell cycle, p53 signaling pathway, Progesterone-mediated oocyte maturation
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...