HSFY1 Rabbit Polyclonal Antibody

CAT#: TA341428

Rabbit Polyclonal Anti-HSFY1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of heat shock transcription factor, Y-linked 1 (HSFY1), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HSFY1 antibody: synthetic peptide directed towards the N terminal of human HSFY1. Synthetic peptide located within the following region: SWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNLYGFSKI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 45 kDa
Gene Name heat shock transcription factor, Y-linked 1
Background This gene encodes a member ofThe heat shock factor (HSF) family of transcriptional activators for heat shock proteins.This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males.The genome has two identical copies ofThis gene within a palindromic region;This record representsThe more centromeric copy. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
Synonyms HSF2L; HSFY
Note Immunogen Sequence Homology: Human: 100%; Dog: 79%; Rat: 79%; Mouse: 79%; Bovine: 79%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...