ZNF101 Rabbit Polyclonal Antibody

CAT#: TA341429

Rabbit Polyclonal Anti-ZNF101 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of zinc finger protein 101 (ZNF101)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF101 antibody: synthetic peptide directed towards the N terminal of human ZNF101. Synthetic peptide located within the following region: EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 50 kDa
Gene Name zinc finger protein 101
Background Zinc finger proteins (ZNFs), such as ZNF101, bind nucleic acids and perform many key functions,The most important of which is regulating transcription (summary by Bellefroid et al., 1993 [PubMed 8467795]). See ZNF91 (MIM 603971) for general information on ZNFs. [supplied by OMIM, Nov 2010]. Transcript Variant:This variant (2) differs inThe 5' UTR, lacks a portion ofThe 5' coding region and initiates translation at a downstream start codon, compared to variant 1. It encodes isoform 2, which has a shorter N-terminus, compared to isoform 1. Sequence Note:This RefSeq record was created from transcript and genomic sequence data to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: DB264378.1, BI838075.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms HZF12
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...