BORIS (CTCFL) Rabbit Polyclonal Antibody
CAT#: TA341444
Rabbit Polyclonal Anti-CTCFL Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CTCFL antibody: synthetic peptide directed towards the N terminal of human CTCFL. Synthetic peptide located within the following region: RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 76 kDa |
Gene Name | CCCTC-binding factor like |
Database Link | |
Background | CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation.This gene is a paralog of CTCF and appears to be expressed primarily inThe cytoplasm of spermatocytes, unlike CTCF which is expressed primarily inThe nucleus of somatic cells. CTCF andThe protein encoded byThis gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jun 2012] |
Synonyms | BORIS; CT27; CTCF-T; dJ579F20.2; HMGB1L1 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |