MATH5 (ATOH7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ATOH7 antibody: synthetic peptide directed towards the C terminal of human ATOH7. Synthetic peptide located within the following region: FGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	atonal bHLH transcription factor 7
Database Link	NP_660161 Entrez Gene 220202 Human UniProt ID Q8N100
Background	This intronless gene encodes a member ofThe basic helix-loop-helix family of transcription factors, with similarity to Drosophila atonal gene that controls photoreceptor development. Studies in mice suggest thatThis gene plays a central role in retinal ganglion cell and optic nerve formation. Mutations inThis gene are associated with nonsyndromic congenital retinal nonattachment. [provided by RefSeq, Dec 2011]
Synonyms	bHLHa13; Math5; NCRNA; PHPVAR; RNANC
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Dog: 85%; Bovine: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.