L3MBTL4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-L3MBTL4 antibody: synthetic peptide directed towards the N terminal of human L3MBTL4. Synthetic peptide located within the following region: STTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSKDQSFPEHENGFQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	l(3)mbt-like 4 (Drosophila)
Database Link	NP_775735 Entrez Gene 91133 Human UniProt ID Q8NA19
Background	Putative Polycomb group (PcG) protein. PcG proteins maintainThe transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility.
Synonyms	HsT1031
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.