Rex1 (ZFP42) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: QKVFEASSLECSLEYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	ZFP42 zinc finger protein
Database Link	NP_777560 Entrez Gene 132625 Human UniProt ID Q96MM3
Background	Involved inThe reprogramming of X-chromosome inactivation duringThe acquisition of pluripotency. Required for efficient elongation of TSIX, a non-coding RNA antisense to XIST. Binds DXPas34 enhancer withinThe TSIX promoter. Involved in ES cell self-renewal.
Synonyms	REX-1; REX1; zfp-42; ZNF754
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Adult stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell - Pluripotency

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.