UPF1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UPF1 antibody: synthetic peptide directed towards the middle region of human UPF1. Synthetic peptide located within the following region: RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	123 kDa
Gene Name	UPF1, RNA helicase and ATPase
Database Link	NP_002902 Entrez Gene 5976 Human UniProt ID Q92900
Background	This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream fromThe last exon-exon junction,This triggers NMD to degrade mRNAs containing premature stop codons.This protein is located only inThe cytoplasm. When translation ends, it interacts withThe protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted forThis gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Synonyms	HUPF1; NORF1; pNORF1; RENT1; smg-2
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Zebrafish: 83%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.