DDX23 Rabbit Polyclonal Antibody
CAT#: TA341572
Rabbit Polyclonal Anti-DDX23 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DDX23 antibody: synthetic peptide directed towards the C terminal of human DDX23. Synthetic peptide located within the following region: EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 90 kDa |
Gene Name | DEAD-box helicase 23 |
Database Link | |
Background | This gene encodes a member ofThe DEAD box protein family. DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The protein encoded byThis gene is a component ofThe U5 snRNP complex; it may facilitate conformational changes inThe spliceosome during nuclear pre-mRNA splicing. An alternatively spliced transcript variant has been found forThis gene, but its biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Synonyms | prp28; PRPF28; SNRNP100; U5-100K; U5-100KD |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Pathways | Spliceosome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |