DDX39 (DDX39A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DDX39 antibody: synthetic peptide directed towards the N terminal of human DDX39. Synthetic peptide located within the following region: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	DEAD-box helicase 39A
Database Link	NP_005795 Entrez Gene 10212 Human UniProt ID O00148
Background	This gene encodes a member ofThe DEAD box protein family.These proteins are characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene is thought to play a role inThe prognosis of patients with gastrointestinal stromal tumors. A pseudogene ofThis gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants ofThis gene have been described, butTheir full-length nature is not known. [provided by RefSeq, Sep 2013]
Synonyms	BAT1; BAT1L; DDX39; DDXL; URH49
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rat: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.