Annexin A3 (ANXA3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the N terminal of human ANXA3. Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	annexin A3
Database Link	NP_005130 Entrez Gene 306 Human UniProt ID P12429
Background	This gene encodes a member ofThe annexin family. Members ofThis calcium-dependent phospholipid-binding protein family play a role inThe regulation of cellular growth and in signal transduction pathways.This protein functions inThe inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate.This protein may also play a role in anti-coagulation. [provided by RefSeq, Jul 2008]
Synonyms	ANX3
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Horse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data
Protein Families	Stem cell - Pluripotency

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.