GJB6 Rabbit Polyclonal Antibody

CAT#: TA341667

Rabbit Polyclonal Anti-GJB6 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of gap junction protein, beta 6, 30kDa (GJB6), transcript variant 3
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GJB6 antibody: synthetic peptide directed towards the middle region of human GJB6. Synthetic peptide located within the following region: CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 30 kDa
Gene Name gap junction protein beta 6
Background Gap junctions allowThe transport of ions and metabolites betweenThe cytoplasm of adjacent cells.They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extracellular loops, a cytoplasmic loop formed betweenThe two inner transmembrane segments, andThe N- and C-terminus both being inThe cytoplasm.The specificity ofThe gap junction is determined by which connexin proteins compriseThe hemichannel. InThe past, connexin protein names were based onTheir molecular weight, howeverThe new nomenclature uses sequential numbers based on which form (alpha or beta) ofThe gap junction is present.This gene encodes one ofThe connexin proteins. Mutations inThis gene have been found in some forms of deafness and in some families with hidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008]
Synonyms CX30; DFNA3; DFNA3B; DFNB1B; ECTD2; ED2; EDH; HED; HED2
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 92%; Mouse: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 85%; Goat: 79%
Reference Data
Protein Families Druggable Genome, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...